General Information

  • ID:  hor005305
  • Uniprot ID:  P80952
  • Protein name:  Skin peptide tyrosine-tyrosine
  • Gene name:  NA
  • Organism:  Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Skin.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Phyllomedusa (genus), Phyllomedusinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0031640 killing of cells of another organism; GO:0042742 defense response to bacterium; GO:0050832 defense response to fungus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY
  • Length:  36(1-36)
  • Propeptide:  YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Shows a broad spectrum of antibacterial activity against Gram-positive and Gram-negative bacteria, yeast and fungi.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80952-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P80952-F1.pdbhor005305_AF2.pdbhor005305_ESM.pdb

Physical Information

Mass: 488922 Formula: C190H292N52O58S
Absent amino acids: CFW Common amino acids: P
pI: 7.52 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: -120.83 Boman Index: -9717
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 56.94
Instability Index: 9851.39 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  7937944
  • Title:  Skin peptide tyrosine-tyrosine, a member of the pancreatic polypeptide family: isolation, structure, synthesis, and endocrine activity.
  • PubMed ID:  8601432
  • Title:  Broad spectrum antibiotic activity of the skin-PYY.